Is this product for human use?

No. CJC-1295 with DAC 5mg is supplied as a reference-grade compound for in vitro laboratory research use only. It has not been evaluated by the FDA and is not intended for human or veterinary use.

How should I store this product?

-20°C, desiccated, protected from light

How is the Certificate of Analysis provided?

When a verified Certificate of Analysis is available for the active lot, it is shown on the product page and through the vial verification view. Contact support before ordering when a specific lot document is required.

Which payment methods do you accept?

Cryptocurrency only — USDT-TRC20 (recommended, lowest fees), Monero, Bitcoin (Lightning + on-chain), Litecoin, Solana, Ethereum, and USD Coin. A 10% discount is automatically applied at checkout for all crypto payments.

CJC-1295 with DAC 5mg – BenchPeptides

🔒 Crypto payments accepted · 📋 Lot-specific quality records · 🚚 Tracked shipping

BenchPeptides

Cart 0

🚚 Tracked dispatch 📦 Live stock status per product 🔬 Lot-specific analytical records 📋 COA shown when available for the active lot 🔒 Crypto payments accepted ✅ Research-use documentation 🚚 Tracked dispatch 📦 Live stock status per product 🔬 Lot-specific analytical records 📋 COA shown when available for the active lot 🔒 Crypto payments accepted ✅ Research-use documentation

Home› Shop› CJC-1295 with DAC 5mg

CJC-1295 with DAC 5mg vial — BenchPeptides

Research use only — in-vitro

5mg · lyophilized

$69.99

Research use onlyLot records when availableTracked dispatchCrypto checkout

Synthetic 30-amino-acid GHRH analog with Drug Affinity Complex (maleimidopropionyl moiety), supplied as lyophilized reference standard for in vitro laboratory research. Not for human consumption.

SKU: BP-CJC1295DAC-5MG Category: Growth Hormone Pathway Tags: DAC, GHRH, peptide, research-only

📋 Lot records when available 🚚 Tracked dispatch 🔒 Crypto payments 🚚 Free shipping €500+

Description

Description

Reference-grade CJC-1295 with DAC (GRF(1-29) Tyr1 + D-Ala2 + Gln8 + Ala15 + Leu27 + maleimidopropionyl-Lys30). Lyophilized powder. Supplied for in vitro laboratory research use only. Has not been evaluated by the FDA. Not intended for human or veterinary use.

Specifications

CAS Number	863288-34-0
Molecular Formula	C152H252N44O42
Molecular Weight	3367.9 Da
Sequence	YADAIFTQSYRKVLAQLSARKLLQDIMSR-K(maleimido)
Form	Lyophilized powder
Storage	-20°C, desiccated, protected from light
Stability	24 months under recommended storage

Biological Activity (mechanism-only)

This compound is supplied as a reference standard for in-vitro and mechanism-of-action research. No therapeutic, performance, or human-outcome representations are made.