Is this product for human use?

No. Retatrutide 5mg is supplied as a reference-grade compound for in vitro laboratory research use only. It has not been evaluated by the FDA and is not intended for human or veterinary use.

How should I store this product?

-20°C, desiccated, protected from light

How is the Certificate of Analysis provided?

When a verified Certificate of Analysis is available for the active lot, it is shown on the product page and through the vial verification view. Contact support before ordering when a specific lot document is required.

Which payment methods do you accept?

Cryptocurrency only — USDT-TRC20 (recommended, lowest fees), Monero, Bitcoin (Lightning + on-chain), Litecoin, Solana, Ethereum, and USD Coin. A 10% discount is automatically applied at checkout for all crypto payments.

Retatrutide 5mg – BenchPeptides

🔒 Crypto payments accepted · 📋 Lot-specific quality records · 🚚 Tracked shipping

BenchPeptides

Cart 0

🚚 Tracked dispatch 📦 Live stock status per product 🔬 Lot-specific analytical records 📋 COA shown when available for the active lot 🔒 Crypto payments accepted ✅ Research-use documentation 🚚 Tracked dispatch 📦 Live stock status per product 🔬 Lot-specific analytical records 📋 COA shown when available for the active lot 🔒 Crypto payments accepted ✅ Research-use documentation

Home› Shop› Retatrutide 5mg

Research use only — in-vitro

5mg · lyophilized

$179.99

Research use onlyLot records when availableTracked dispatchCrypto checkout

Synthetic 39-amino-acid triple agonist (GIP/GLP-1/glucagon receptors) with fatty acid moiety, supplied as lyophilized reference standard for in vitro laboratory research. Not for human consumption.

SKU: BP-RETA-5MG Category: GLP-1 / Metabolic Tags: GIP, GLP-1, glucagon, peptide, research-only

📋 Lot records when available 🚚 Tracked dispatch 🔒 Crypto payments 🚚 Free shipping €500+

Description

Description

Reference-grade Retatrutide (triple GIP/GLP-1/glucagon receptor agonist analog). Lyophilized powder. Supplied for in vitro laboratory research use only. Has not been evaluated by the FDA. Not intended for human or veterinary use.

Specifications

CAS Number	2381089-83-2
Molecular Formula	C236H369N51O73
Molecular Weight	5163.9 Da
Sequence	Y-Aib-EGTFTSDYSIYLDKIQKAFVQWLLAQGPSSGAPPPS (modified)
Form	Lyophilized powder
Storage	-20°C, desiccated, protected from light
Stability	24 months under recommended storage

Biological Activity (mechanism-only)

This compound is supplied as a reference standard for in-vitro and mechanism-of-action research. No therapeutic, performance, or human-outcome representations are made.