Description
Reference-grade Tirzepatide (dual GIP/GLP-1 receptor agonist analog). Lyophilized powder. Supplied for in vitro laboratory research use only. Has not been evaluated by the FDA. Not intended for human or veterinary use.
Specifications
| CAS Number | 2023788-19-2 |
|---|---|
| Molecular Formula | C225H348N48O68 |
| Molecular Weight | 4813.5 Da |
| Sequence | Y-Aib-EGTFTSDYSIYLDKIAQKAFVQWLIAGGPSSGAPPPS (modified) |
| Form | Lyophilized powder |
| Storage | -20°C, desiccated, protected from light |
| Stability | 24 months under recommended storage |
Biological Activity (mechanism-only)
This compound is supplied as a reference standard for in-vitro and mechanism-of-action research. No therapeutic, performance, or human-outcome representations are made.