All products are supplied for laboratory research use only — not for human consumption, therapeutic, or veterinary use.
🔒 Crypto payments accepted  ·  📋 Lot-specific quality records  ·  🚚 Tracked shipping
🚚 Tracked dispatch 📦 Live stock status per product 🔬 Lot-specific analytical records 📋 COA shown when available for the active lot 🔒 Crypto payments accepted ✅ Research-use documentation 🚚 Tracked dispatch 📦 Live stock status per product 🔬 Lot-specific analytical records 📋 COA shown when available for the active lot 🔒 Crypto payments accepted ✅ Research-use documentation
Home Shop Tirzepatide 5mg
Research use only — in-vitro
5mg · lyophilized

$149.99

Research use onlyLot records when availableTracked dispatchCrypto checkout

Synthetic 39-amino-acid dual GIP/GLP-1 receptor agonist analog with C20 fatty diacid moiety, supplied as lyophilized reference standard for in vitro laboratory research. Not for human consumption.

SKU: BP-TIRZ-5MG Category: Tags: , , ,
📋 Lot records when available 🚚 Tracked dispatch 🔒 Crypto payments 🚚 Free shipping €500+

Description

Reference-grade Tirzepatide (dual GIP/GLP-1 receptor agonist analog). Lyophilized powder. Supplied for in vitro laboratory research use only. Has not been evaluated by the FDA. Not intended for human or veterinary use.

Specifications

CAS Number 2023788-19-2
Molecular Formula C225H348N48O68
Molecular Weight 4813.5 Da
Sequence Y-Aib-EGTFTSDYSIYLDKIAQKAFVQWLIAGGPSSGAPPPS (modified)
Form Lyophilized powder
Storage -20°C, desiccated, protected from light
Stability 24 months under recommended storage

Biological Activity (mechanism-only)

This compound is supplied as a reference standard for in-vitro and mechanism-of-action research. No therapeutic, performance, or human-outcome representations are made.